GenomeNet

>nfi:NFIA_065200 K17862 linoleate 10R-lipoxygenase [EC:1.13.11.62] | (RefSeq) animal haem peroxidase family protein (A)
MLRRFSSTFKKKGDRESKQNGTAAAVANTNNNDNNKRHSKISAARKSSSDDDRNEKKGDS
VSPFEKYASVLHASRSPIPNQTGDGAYLEHEHTTSLLQDARHLGFKDFKTLKEVIESKLP
GGQLIDDKTMLMERIIQLVSRLPHNSKHREELTNAFLTELWDSLPHPPLSYMGNDYAYRS
ADGSNNNPTLPWLGAANTPYARTIAPLIIQPGGLPDPGLVFDTLFARQTFKPHPNKVSSV
FFDWASLIIHDIFQTDYKNPNVNKTSGYLDLSILYGDVQEEQNLIRTFKDGKLKPDSFSE
PRLQAFPATCCVLMVMLNRFHNYAVEQLAAINEDGRFTKPADNLSEEEAKKAWAKYDEDL
FQTGRLITCGLYINITLYDYLRTIVNLNRTNSTWCLDPRAQMEGSRTTPSGLGNQCSVEF
NLAYRWHSAISATDEKWTEDVYERLMGKPASEVSMTELLMGLGKYQAELPKDPSKRTFAD
LERQADGKFKDEDLVNLLVNAVEDVAGSFGARNVPKVLKNVEILGIIQSRKWNVGSLNEF
RKFFGLKPYETFEEINSDPDVAESLRSLYDHPDFVELYPGIVAEEAKQPMVPGVGIAPTY
TISRAVLSDAVALVRGDRHYTIDYNPRNLTNWGYSEVRYDLSINQGCVFYKLATRAFPNW
FKPDSIYAHYPMTIPSENRKIMKDLGRESHYSWDRPRYTPPRVDLVSYSNAKLVAEQQNQ
FRAAWDDTVEFVFGKASKEFKLSQDSAFIQKHADVMSKLLNKEEWHRSVKEFYEDITTKL
LEDKTRRFGGLNQVDITKDVGNLAPVIFASNVFSLPLRSKENSRGIYTEHEMFKVLATLY
NCLYFDIDKTKSYPLYHASQAVGEPLGKALEASVKALGGSSLLSGIFGSFRENNNALKEY
GVHMTKQLLENGLGAHEIAWAQILPTVIAMVPGQAQAFTQIVDFYLSKEGSKHLPEIQRL
AKQDTKESDEQLLRYCLEAVRLNDHSGLYRQSETTLAVTDEAGEVTIQPGDKVFVSFAKA
NRDASVFPDPEEVRLDRPMNSYISPNLGPHGFLSKETSHIALTAMLRTVGRLNNLRVAPG
VQGQLKKIPQPGGYSAYLREDHGSYSVFPTTFRVQYDA

BLAST