GenomeNet

>ngr:NAEGRDRAFT_30605 K01556 kynureninase [EC:3.7.1.3] | (RefSeq) hypothetical protein (A)
MIPKELICQVDENSSDECVEKKIIYFCGNSLGLQPKCLSKNIEKELQKWAHIGVEGHFSA
SFGTNKWFEVEESVKNAMAKVVGAKPIEVTVMNSLTANLQVLLTSFYRPTAQKYKILVEQ
YPFPSDMHAVTSHVRCRIEELRSMLGSHLSSDEIVEKCITLVGPREGEEIIRSEDIVECL
KSDSSIALSLVGGVQFMTGQCFDMKTIAQTCQELDIVCGFDLAHAAGNIDLRLHDWGVDF
ACWCSYKYLNSGPGGISGIFVHEKHSNETMEQRPRFMGWWAREKATRFSLSTKFEPQPGA
AGFQMSNPCILSMTAILSSLRVFEMAEKDGQIMSVLRSKSNLLTTYLELLIRQELSDKIF
ILTPSNPNARGCQLSIRVLHKNLDYVDSELKKRGVIIDIREPDIIRVSPTPLYNQFVEVY
DFVQLLKEILN

BLAST