GenomeNet

>ngr:NAEGRDRAFT_4440 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
NQLDTRKKNLKFAKSPIHDWGLFALEDIEQGEMVIEYVGEVIREALSDIREKRYEQIGIG
SSYLFRLDNDLIIDATKRGNLARFINHSCDPNCCARIIEVDKQKKVCIYALRKILVGEEI
TYDYKFPIEESKIPCKCGSQKCKKWLN

BLAST