GenomeNet

>ngr:NAEGRDRAFT_71505 hypothetical protein (A)
MVVEIAYFAGPGRAEVLKLIAEVGQVEYTFKGIPREEWPNHKVTCRYGQLPYLKINDETT
LYQTIAIARYLAQEGGLYPTDRLEASASEEYVAAIDDIIAGFVRIFFRTPEEKREEELKA
FSEGILKTTLVAFEKVLEKNEGNLVKGKLTWADLVLYDIVVNIQSKGADISYAQNVLKLK
ETVAAHERVKAFLESDRNLRKQQ

BLAST