GenomeNet

>ngr:NAEGRDRAFT_71505 K04097 prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] | (RefSeq) hypothetical protein (A)
MVVEIAYFAGPGRAEVLKLIAEVGQVEYTFKGIPREEWPNHKVTCRYGQLPYLKINDETT
LYQTIAIARYLAQEGGLYPTDRLEASASEEYVAAIDDIIAGFVRIFFRTPEEKREEELKA
FSEGILKTTLVAFEKVLEKNEGNLVKGKLTWADLVLYDIVVNIQSKGADISYAQNVLKLK
ETVAAHERVKAFLESDRNLRKQQ

BLAST