GenomeNet

>nha:Nham_4050 ribulose bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGCFSFLPDLTDEQISKQIQYCLTQGWAVNIEFTDDPHPRNTYWDMWNLPMFDLKD
AAGVLMELNECRKVYGDRYIRMSAFDSSHGWESVKISFIVNRPKDEPGFRLERQESDNRN
IRYTTTSYAVTARPEGQRYSS

BLAST