GenomeNet

>nhe:NECHADRAFT_106311 SDG2102; hypothetical protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MEDDEYTTSKMGEIKLEEGANGARVKQEGSASMTTTNDSHDGSRSPTASHDGVKSRSESA
DTPSSTKPPRLSRKVSQKLAATREPALFDHLPDVTTESYNFFQVIPDCLYGSKHLGSTDN
DSLDCECREEWRDGENLACGEDSDCINRATKMECSAEAGNCGGGCQNQRFQRKQYANVSV
IKTEKKGFGLRADADLQPNDFVYEYIGEVINEPTFRRRMLQYDEEGIKHFYFMSLNKSEF
VDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFTLRKIQSGEELVFNYNVDRYGAD
PQPCYCGEPNCVGFIGGKTQTERATKLPTATVEALGIDGGDGWDTSVAKKPRKKKPDEDD
EEYVNSIQPRNLSEDDARKVMATLMQCKEKWIAVKLLERIERCDDERVIHCVMRMHAYQI
LKTALNTFLDDHNLVIQILTILDKFPRLTRNKIQDSKIEATVEGLTHSDHEDVATRSKKL
LDEWSKLEVGYRIRRRKFDPNAPTANSFEERRGAGREDEAAQSTSKTTSPFNNVEVPKGP
RNSVPQRNNAFFHNGGRPRRAPFNAPLPRGWFTAKDAAGNTYFYNKQGVTTWQKPTQPAG
ESVAKAPSKAMKEQLAIQSIIDQVTEKGTPKHPTVSTPKAAETPTKEPKPEKWRSLPIEK
QMKIYENTLFPHIKHVLDKFHHKLPKEELKRLGKDIAKKLVASDYKNNRVGDPSSPLSDK
QAKKMRKFVNDFLDRAVEKYGEHQKRKAARASQKETNDGEGLDERADRNGGSAADRPAGS
SHAKDDVPMADELDEAALSDNDGPRSSTSPDRKRKREVEVEASGSPSLASSEGPTVKRVR
EDEMDEPSPPPPPPPPPQSAMENVMTAEQQALREQEEALVRENEEAQRLEDEANRTKCTE
DATRGAEKDAPLASNEPSQLSHEAQGSA

BLAST