GenomeNet

>nhe:NECHADRAFT_12117 K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] | (RefSeq) SDG2118; hypothetical protein (A)
MPPSKNAPAKKQRITLAQLSAYDDILTDALVDHVFYWTTVPKNRTSYHPSRGVREEEITK
VLQEEVVINKDLDAAEKRLLKTDGLKRFYNGLRTDKEKEDFRRHLRRYVQIYMPDCPWEV
SSTNRYTIVSHEAAVHARRYIKRNESIKYLSGVQVIITPEEEKAISSQKKDFSIVVSSRS
KCTSLFMGPARFANHDCDANAKLMRTSHAGIEIIATRAIGPGEEITVTYGDNYFGDNNCE
CLCKTCEDLLRNAWEPEEGSVAVKKSIEQEKSDGYSLRRRRRDDSISGSSRTPSVTPDMR
PRVPKATRHSLLGHARDSSAARSPPAETNSRKRPLDALATPPKTPAKRQKRSAEPVSRED
SSSRSSSVTASESSGSGVVETDVTSPEKETPEPMVKTPVMKEAIPMAIDQGRTQAVPQVA
PVSPQSTEGSRSPQTKTEASTAGPNGRNGLESMSIRAILNAPLESEMEPQPEPEKALEAV
PEPETVPIATSIETVEEGQAADEDEQPKRRKYQRRTFVKQPTPPSRVRTPGDYLLTPLLL
SEPEMAWIQCTICDGYFVQQNAYFTRSSCPRCERHSKLYGYIWPKTDKAGPHDKEERVLD
HRTIHRFLDADDERRVRGRK

BLAST