GenomeNet

>nhe:NECHADRAFT_36746 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) glk1; hypothetical protein (A)
MALADESNRVVQEFDFSNDDLNRHVKEFLRQMNEGLSQEGTSLQQIPTYVTGVPNGTEKG
LYLAVDLGGTNFRVCSIMLNGDTTFNLTFNKVAIPKELMVAKTSSELFSFLAKQIEVFLK
EHHAEHFNSHLRRRNTYSTASGYRDEHIFRLGFTFSFPVKQLAINKGLLIRWTKGFDIRD
AVGKDVCALLQTEIDKLQLPVKVAALVNDTVGTLMARSYTSTGKSRSILGAIFGTGTNGA
YMEKLDNIKKPITGDYDQSTGEMVVNTEWGSFDNQLNVLPSTAWDKALDAQSVNPGDQMF
EKRVSGMFLGEIVRLAVADMINSEKSSLFKDLNSSSNDWGSTTNIAPQSGFLKPWGLDSS
IMSVAAADNTPELSTLRQELENLLHVYTPSLEDAQAFKSVSNAVGRRAARLSAVAIGAIA
LQSGKLEDPNEEVIDIGVDGSLVEHYPFFRDMIYEALRAIDGIGPKGAEKIRIGIAKDGS
GVGAALIALVAAGREKPEDYLVDIKAESNRGRKLSNAIGT

BLAST