GenomeNet

>nhe:NECHADRAFT_36746 glk1; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MALADESNRVVQEFDFSNDDLNRHVKEFLRQMNEGLSQEGTSLQQIPTYVTGVPNGTEKG
LYLAVDLGGTNFRVCSIMLNGDTTFNLTFNKVAIPKELMVAKTSSELFSFLAKQIEVFLK
EHHAEHFNSHLRRRNTYSTASGYRDEHIFRLGFTFSFPVKQLAINKGLLIRWTKGFDIRD
AVGKDVCALLQTEIDKLQLPVKVAALVNDTVGTLMARSYTSTGKSRSILGAIFGTGTNGA
YMEKLDNIKKPITGDYDQSTGEMVVNTEWGSFDNQLNVLPSTAWDKALDAQSVNPGDQMF
EKRVSGMFLGEIVRLAVADMINSEKSSLFKDLNSSSNDWGSTTNIAPQSGFLKPWGLDSS
IMSVAAADNTPELSTLRQELENLLHVYTPSLEDAQAFKSVSNAVGRRAARLSAVAIGAIA
LQSGKLEDPNEEVIDIGVDGSLVEHYPFFRDMIYEALRAIDGIGPKGAEKIRIGIAKDGS
GVGAALIALVAAGREKPEDYLVDIKAESNRGRKLSNAIGT

BLAST