GenomeNet

>nhe:NECHADRAFT_40259 hypothetical protein (A)
MSSAEVKNGHATNGHSQEKAPAPKPQPKAAGQSNQKKEGALKSFKKLRVLSKRPLPTEMG
DGSYRTVVNRPRLKEDLRRLKIKDLKTLLEIVKAKAKGETQQDDKTMIMERTIQIVASLN
DHSKVQEVLTNSFIDKLWNSLDHPPMLYMGDQYRFRQPDGSLNNPYMPKLGAAKTPYSRS
VRPKGMSLGAQPDPEAVFESVMARDGFKKNPNNVSSILWYWATIIIHDLFWTNLKDPNQN
DSSSYLDLSPLYGSTVEARDSIRTFEDGLLKPDTFADKRLIGNPPGVCIILIMFNRFHNH
VATNLADINEGGRFSKPGPNLDPEAAAAAWKKRDEELFETARLVTSGLYINITLIDYVRN
IINLNRVDTTWTLDPRQEMGVSVGTKEGSESGTGNVVSAEFNLCYRWHSCISEMDDKWIQ
DFYVQLLGDNYGAMDMRALMMALKKFEMSVPQDPAERTFGGFKRGKDGKFSDNELVDALA
TAIEQPGGAFGGRNVPRIMKPVEMLGIIRGRKWNLAGLNEFRKHFGLKAYDTFEEINSDP
EIAESLRNLYQHPDYVELYPGIVAEEAKTPMVPGVGIAPTYTISRVVLSDAVALVRGDRY
YTTDYHPRNLTNWGYKEVDYDLNINHGCVFYKLFIRAFPQHFKGNSVYAHYPMVIPSENR
KILTDLKRADRFDFDRPSFTPARINIVGYNAAKYILENQEIYKVCWDEGLGHLMGEGGRR
FMLSGDGAFFAQQRRCMGALLYNDTWKSAIKSFYSMIAEKLLAEKSYKLAGKTQVDVVRD
VGNLAHTHFVSRMFNLPLKTKENPKGLFSEQELYKILAVIFVCIFFDIDPAKSFPLRQGA
REVAQALGKVVEMNVKLSNGIGMKGLFTGKANKDDPLAAYGVNMAKGLKKAGLSTEDIVW
SQILPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELHRIAALETGDETDALLLGYAMEG
IRMAGTFGLYRKAESADVIEEDNGERVEVKAGDRVFVSFVSAAKDPKIFPNPEVVDPRRP
LESYIHYGTGPHECLGRNISQVALTELFRALFRKKGLRRVPGAQGELKKVPRPGGFYVYM
TEDWGSIWPFPTSMKVTWDGE

BLAST