GenomeNet

>nhe:NECHADRAFT_40259 hypothetical protein; K17862 linoleate 10R-lipoxygenase [EC:1.13.11.62] (A)
MSSAEVKNGHATNGHSQEKAPAPKPQPKAAGQSNQKKEGALKSFKKLRVLSKRPLPTEMG
DGSYRTVVNRPRLKEDLRRLKIKDLKTLLEIVKAKAKGETQQDDKTMIMERTIQIVASLN
DHSKVQEVLTNSFIDKLWNSLDHPPMLYMGDQYRFRQPDGSLNNPYMPKLGAAKTPYSRS
VRPKGMSLGAQPDPEAVFESVMARDGFKKNPNNVSSILWYWATIIIHDLFWTNLKDPNQN
DSSSYLDLSPLYGSTVEARDSIRTFEDGLLKPDTFADKRLIGNPPGVCIILIMFNRFHNH
VATNLADINEGGRFSKPGPNLDPEAAAAAWKKRDEELFETARLVTSGLYINITLIDYVRN
IINLNRVDTTWTLDPRQEMGVSVGTKEGSESGTGNVVSAEFNLCYRWHSCISEMDDKWIQ
DFYVQLLGDNYGAMDMRALMMALKKFEMSVPQDPAERTFGGFKRGKDGKFSDNELVDALA
TAIEQPGGAFGGRNVPRIMKPVEMLGIIRGRKWNLAGLNEFRKHFGLKAYDTFEEINSDP
EIAESLRNLYQHPDYVELYPGIVAEEAKTPMVPGVGIAPTYTISRVVLSDAVALVRGDRY
YTTDYHPRNLTNWGYKEVDYDLNINHGCVFYKLFIRAFPQHFKGNSVYAHYPMVIPSENR
KILTDLKRADRFDFDRPSFTPARINIVGYNAAKYILENQEIYKVCWDEGLGHLMGEGGRR
FMLSGDGAFFAQQRRCMGALLYNDTWKSAIKSFYSMIAEKLLAEKSYKLAGKTQVDVVRD
VGNLAHTHFVSRMFNLPLKTKENPKGLFSEQELYKILAVIFVCIFFDIDPAKSFPLRQGA
REVAQALGKVVEMNVKLSNGIGMKGLFTGKANKDDPLAAYGVNMAKGLKKAGLSTEDIVW
SQILPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELHRIAALETGDETDALLLGYAMEG
IRMAGTFGLYRKAESADVIEEDNGERVEVKAGDRVFVSFVSAAKDPKIFPNPEVVDPRRP
LESYIHYGTGPHECLGRNISQVALTELFRALFRKKGLRRVPGAQGELKKVPRPGGFYVYM
TEDWGSIWPFPTSMKVTWDGE

BLAST