GenomeNet

>nhe:NECHADRAFT_43928 hypothetical protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MGSQQEQRPQTEDAKHEDEIQYGTVGITQEEMEEKYPNRPKNHSKTLVFSELFRELFNPL
SENKKQNATGAGPRKAFRGVNKLSPHEQRRHIIERFIIRWRKEVGPDFYPALRLILPDKD
RDRGVYGLKENAIGKLLVKLMKIDKSSEDGYNLLHWKLPGQTTASRLAGDFAGRCFEVIS
KRPMRTTVGTMTIAEVNEQLDKLAASTGETENLRIFETFYNHMNAEELMWLIRIVLKQMK
VGATEKTFLDLWHPDGDALFSVSSSLRRVCWELSDPEIRLEQDEAGVALLQCFQPQLAQF
QMPASFQKMIQLLRPTEEDPEFWIEEKLDGERMQMHMVEDKKHPGGRRFCFWSRKAKDYT
YLYGDGLQDENSSLTRHLKKAFASGVKNLILDGEMITWDMGVDKIVPFGTLKTAALAEQQ
NKSDTNSAGHRPLFRVFDILYLNNKPLTQYTLRDRHRALEKAVKSVHRRLEIHNYTSATT
SDAIEPLLREVVANASEGLVLKNPRSMYRLNHRNDDWLKVKPEYMSEFGESLDCVIIGGY
YGSGKRGGMLSSYLCGLRVTQNHIQAGANPEKCFSFFKVGGGFRAEDYAEIRHRTEGKWI
EWDQKNPPSEYIELGGGELRQYERPDMWIRPKDSVVVSVKAASVGPSDQFARGFTLRFPR
FRRLRLDRTWDTALSLEEFQELKDRVDEESKEKAMTVEDRKRRNPKRIKRELVIAGEDSA
PVEFEGEKTKLFEGLEFCVLSEALKPYKKTKTQLESIIKENGGTISQRAAPGTNMVLIAD
KKVVKVASLMKGGDVDLIRPKWIKDCLEQDLGQFLLPFEESHLFHATEAMKRAAEQNTDQ
FGDSYARDMSIDELKDLMDCMPKIEDGEPFNKNEFLQQLEDHGKDLGNLRSFIFRRCVVL
FHGVDTGINRVSRLKHFVKYGGGSVTEDAGDLSVTHVVIEGGDPMQMGEAADMVRKELSS
RRTQPRVVAGKWIEDCWKEGTLLDEEQFVVP

BLAST