GenomeNet

>nhe:NECHADRAFT_49470 SDG2101; histone H3 methyltransferase complex protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MTRPPGASFAQFFPTAPKVKAQAQSRADRDRDRDRPKTTSSSASINGGASDPTPASAGFD
AHANASAQPAPGPNGHLAVSDTLSAHPDDNGSPLADIPSTVDSASSYSSAASSIFSTSAR
HGAAATATSSRLPTSSLTPIASKDSPSNSSATAPTKPDMSASLAADRAARQSSHNSPAVG
PNGSISDGPLAIERPPARDPMPSVKGLKCTYDPLLDRVHNKSVSRNAKPTYKEFGRDDDA
PPTDPRLSKPGGRLGYINTDYYLPKARLRPAPENIKPYPYDPKTSIGPGPPTQIVVTRYN
PLVPFSKVTAIFATFGEIAESSNKMHPETGSYLGFATIRYRDSKRPDRPRVSAIDAARRA
VRTRGIKVDADVVRVDYDPEGRRSRRMLEEHLRREKERMEKKEKERLAQAVQAPPIGPKS
TPASNFTRPPPTAPKGPAAQRPAGAPSTPQPTTTPVQPKGHAAVEVKNLASQLTDDPYIY
IAGDSVPVLTSIVPHMKKRLKNYGFEDIRLDKSGYYIVFRNSFTGKSEAERCFRAVNHTE
FFNYDMTMQLCLPRPRRSDESPERRRQASASPDRKPRGETGQRDEKDRRRREEEADLEEE
KKQRAKNFDPVIEAVEVVRREMTEHLIRHIRTKVAAPFLSEFLDPANHVAKRRKLNIEHP
DDIEEIPSIEDGNDSSRVGTPNSRADPIERRTGRLEPKALPRIRKTKVKGQAQRSAFIDP
FARQRPVARNAFRSLHHRLRSLDSDVESDDDTDTRALLARETEEPESRPRSRMSTDDEAS
KDDFASWGPGEDDSMTEASFHITDPLISRKRKLDASVETAFKRQKKSDEELFGVKLGQLG
TGFVAREDSVDIIPEPETGDDLESRVSRSETPASVIGKTLKKKPAKAKKKTKKAVFEERE
ALKRQAETDSQRGDEDEVVEAPKAEPKVEEKPPVAEPVPEPVVEKYDEKLLSTEPLTPAL
VLPDGFKPDLSLFQGLALGVNDKPDVAKLSKRFAVKDIGDPELWLWKRNRIRELNSTKGT
LEKPVSIEGYYVPNPTGCARTEGVKKILNSEKSKYLPHHIKVQKARQEREARFKKSGKDA
AAAAAEAAKLAAEKLIAKGNSRANRATNRRYVADLNDQKKTLGQDSDVFKFNQLKKRKKP
VKFARSAIHNWGLYAMENIAKDDMIIEYVGEEVRQQIAEIRENRYLKSGIGSSYLFRIDE
NTVIDATKKGGIARFINHSCMPNCTAKIIKVEGSKRIVIYALRDIAMNEELTYDYKFERE
IGSLDRIPCLCGTAACKGFLN

BLAST