GenomeNet

>nhe:NECHADRAFT_49794 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MELSGFVDRLRSGASPKFPQDANSLEFARHLDSQDKLSHLRDEFVIPTKRSLKKKALDGS
IPSHGASSNGTNGTNGHSNGHNGSSDDSEQCLYFVGNSLGAQPKAVREYLNAQLETWASI
GVNGHFSAMGNSPLTPWQDMAEDCAIKSADIVGASPSEIVIMNTLTANLHFLMASFYKPN
EKRHKIILEWKPFPSDHYAIESQVVWHGLDPEKSMVKIHPNDDFIITTDLILSTIDEHAE
DTALLLLPGIQYYSGQLFDIPRITAYAQERGIVVGWDLAHAAGNVELKLHDWNVDFACWC
TYKYINAGPGSIAGAYVHEKHGKVEFKDDSGKPTYRPRLMGWYGGDKSVRFNMDNKFVPT
VGAGGFQLSNPSAIDLASLSGALSVFNKTKMYEIRSKALVLTAYAEHLLDQIISESSDET
PLFRIITPRDPAQRGTQLSVLLREGLMERVSEALEENGVICDKRKPDVIRVAPVPLYTRF
EDVWKFMQVLRGALSQ

BLAST