GenomeNet

>nhe:NECHADRAFT_49794 K01556 kynureninase [EC:3.7.1.3] | (RefSeq) hypothetical protein (A)
MELSGFVDRLRSGASPKFPQDANSLEFARHLDSQDKLSHLRDEFVIPTKRSLKKKALDGS
IPSHGASSNGTNGTNGHSNGHNGSSDDSEQCLYFVGNSLGAQPKAVREYLNAQLETWASI
GVNGHFSAMGNSPLTPWQDMAEDCAIKSADIVGASPSEIVIMNTLTANLHFLMASFYKPN
EKRHKIILEWKPFPSDHYAIESQVVWHGLDPEKSMVKIHPNDDFIITTDLILSTIDEHAE
DTALLLLPGIQYYSGQLFDIPRITAYAQERGIVVGWDLAHAAGNVELKLHDWNVDFACWC
TYKYINAGPGSIAGAYVHEKHGKVEFKDDSGKPTYRPRLMGWYGGDKSVRFNMDNKFVPT
VGAGGFQLSNPSAIDLASLSGALSVFNKTKMYEIRSKALVLTAYAEHLLDQIISESSDET
PLFRIITPRDPAQRGTQLSVLLREGLMERVSEALEENGVICDKRKPDVIRVAPVPLYTRF
EDVWKFMQVLRGALSQ

BLAST