GenomeNet

>nhe:NECHADRAFT_55898 K01186 sialidase-1 [EC:3.2.1.18] | (RefSeq) hypothetical protein (A)
MRNADKLPNGVGFHSFRIPAVVTTTTGRILAFAEGRRHNNRDYGDVNLVYKRTKTTNSHG
ESPSDWDALREVVGKGDGTWGNPTPVVDGSTIYLFLSWNHGAYSQNGGDTLPSGKKTKKI
NNSWEGRRHIFLTQSADDGKTWSEPVDMTKQLTPDGWSWDAVGPGIGITLSSGELVIPAQ
GRNIIGRGKPGKRTWSYQSLKGAGSEGTVAQTPDGKLYRNDRASADDEYRKVARGSLSAF
SPFVLDKGLPDPACEASTLLYNKKDANGPARTLFMNSAHKSSRRHMRVRISYDGDAKKFN
YGRKLSDAPISGVGFEGGYSSLTKTADRKVGALVETDFYQAGGSENDHRAIVWRRFNLSW
ILNGPNN

BLAST