GenomeNet

>nhe:NECHADRAFT_72534 hypothetical protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MSVGTYSLPALPYAYDALEPSISAQIMELHHSKHHQAYVNNLNAALKTYASATSSNDIAG
QIALQSAIKFNGGGHINHSLFWENLSPSSSPDSKPDSAPTLVAEISKTWGSLEAFQETFK
KTLLGLQGSGWGWLVKDTQGLRIVTTKDQDPVVGGEVPIFGVDMWEHAYYLQYLNGKAAY
VDNIWNVINWKTSEARFVGTREDAFKVLRASI

BLAST