GenomeNet

>nhe:NECHADRAFT_94199 K11419 histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43] | (RefSeq) SDG2104; SET domain protein (A)
MEKATERHFFYHGKEGYEDERDGCHWCQIRSFATHSTIPITVVNEEDSEFLPDDFRFINN
MVLGEGVEPAGDSFRSGCSCANDGDCQYTSCLCLADLAEDESSDDEDDDPFGDRIDGMDV
DVPKVHRKAYAYHTHGSKAGLLRSKFYDSKVPIYECHQGCSCSINCPNRVVERGRTIPLQ
IFRTEDRGWGVRSPVHIKKGQFVDRYLGEIITSTEADRRRSKSAISQRKDVYLFALDKFT
DPNSYDPRLKGPPLEVDGEFMSGPTRFINHSCDPNMRIFARVGDHADKHIHDLALFAIKD
IPKGTELTFDYVDGVSNDGEEPEGDVDHMTRCLCGSKKCRKFLW

BLAST