GenomeNet

>nhl:Nhal_3860 ubiquinol-cytochrome C reductase, iron-sulfur subunit (EC:1.10.2.2); K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] (A)
MSTDSVDQGKRRFLTTTATVVGGVGMGFTAVPFVKSMQPSERAQAAGAPVEVDISNLEPG
QLMTVEWRGKPVWILRRTQEEIESVEALTESSTLRDPLSEEEAQQPPFAQNVYRSIEPEI
LVVIGICTHLGCSPTFRPEVAPPDLGPDWQGGFFCPCHGSRFDMSGRVYAGVPAPTNLVV
PPYRFLAENRLLIGETPGETA

BLAST