GenomeNet

>nhl:Nhal_3860 K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] | (GenBank) ubiquinol-cytochrome c reductase, iron-sulfur subunit (A)
MSTDSVDQGKRRFLTTTATVVGGVGMGFTAVPFVKSMQPSERAQAAGAPVEVDISNLEPG
QLMTVEWRGKPVWILRRTQEEIESVEALTESSTLRDPLSEEEAQQPPFAQNVYRSIEPEI
LVVIGICTHLGCSPTFRPEVAPPDLGPDWQGGFFCPCHGSRFDMSGRVYAGVPAPTNLVV
PPYRFLAENRLLIGETPGETA

BLAST