GenomeNet

>nis:NIS_0595 ispDF; bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein (EC:2.7.7.60 4.6.1.12); K12506 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12] (A)
MSDLTLVLLGAGNSSRFGLDVKKQWLWCGNEPLWLYVTNRFTDMFPFHDVVITAHPKEIP
FYKKFCHHTIVKGADTRQQSLLNALEMVKTPYVLVSDIARPCIQKEVVQKIIDNRSKAAC
IVPYIQPADTVVYKNETIDRNEVKLIQTPQLSSTDILRKALTQGKEFTDESSAIQALGEK
VFYILGNRKQHKLTYKEDMKLLNCLQKPSATKRIGNGLDVHAFCEDRKLYLCGIEIPYDK
GLAGHSDADVAIHALIDALLGAAGFGDIGELFPDSDETYKDIDSKKLLCETVRLLRACGF
VIEHVDLTIVAQNPKIGPFKEKMKESLHDLLQIPYHLINLKATTTEHLGFVGRNEGIAAM
ATATLHYFDWSEI

BLAST