GenomeNet

>nko:Niako_2799 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) glycosyl hydrolase BNR repeat-containing protein (A)
MKLNIFITKVILICLIPAFAVARPSGDIVISQQHYQVPILLQKKDNPVLRIHLHNGSAGD
LQLTEMMFNVAGTTDCKDIKQFNLYYTGADSGMRNLGSVEKIQLVGSVTKVGEKLSVTGS
QSLSPGDHYFWLSVELNKGVPLTHVVAVNATNAMMNGKSTKIEGVAKFQQRIGIALRQHN
QDSVHTYRIPGLSTAKDGSLLAIYDVRRESARDLQGNIDIGVSRSTDGGNTWLPMQIAID
MGKWGGLPEKFNGVSDANVLVDKNTGAIFIAGLWMHGVLSEEGIWVEWLTDTSTNWNHQW
RNKGSQPGFDEKHSAQFMIVKSVDNGKTWSKPVNITQQCKQEAWWLWAPAPGAGITLHDG
TLVFPTQGRDKSGKAFSNITYSKDGGVTWHTSNRASKESTTENMAVELSDGTVMLNMRCN
KNQKDTGDTNGRVIAITRNLGEDWTEHPTSRGALHEPVCMASILRHKYVVKGQKKSILLF
ANPDSKTLRHHMTIKVSYDDGATWQTNKKILLDEWKSRGYSCMTSIDAETIGIVYESSQC
DLVFQQVKIKELLP

BLAST