GenomeNet

>nko:Niako_5031 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFIEPNISGERRGSIEVICGSMFSGKTEELIRRLKRAKIANLRVEIFKPKIDVRYDVHNI
VSHDENAILSTPIDNSQTILLLHNEADVIGIDEAQFFDDQLPDVCDQLALRGHRVIVAGL
DMDYTGKPFGQIPFLLSKADYITKLHAICVKCGHIANYSFRKKADKTQVLLGEKDVYEPR
CRKCYYEGAVENG

BLAST