GenomeNet

>nko:Niako_7276 glycoside hydrolase family protein; K12308 beta-galactosidase [EC:3.2.1.23] (A)
MGINKRWVSGLLGILFTGTVIAQGNHTFEIKDGQFVYDSKPVQIHSGEMHYARIPAPYWR
HRLQMIKAMGLNTVATYVFWNYHNPSPGVWDFTTGSHNIREFLRIAREEGMFVILRPGPY
ACAEWEFGGYPWWLLKDTSLVIRAYNQPFLDSCKTYINKLAEQVKDQLVSKGGPIIMVQV
ENEFGSYVAQRKDIPLAEHQRYNEAIHQLLIKSGLTGPFFTSDGSWLFDGGSLPGVLPAA
NGEGDVENLKKQVNKYHNNQGPYMVAEYYPGWLHHWTEPFPNIPAKQVTDQLEIYLKGDV
NFNVYMVHGGTNFAFTSGANYDKDHDIQPDLTTYDYDAPISEPGWATPKYLAVRELMKQY
VKYPVPEIPAQIPVITLPPIQLSKSMDLFDWKKTIKPVVADTPLTFEALNQGHGYVLYSK
KFGQAVQGILQINGLRDYAVVYVDGKNVAVLNRVNKHYTATVEIAANSTLDILVENMGRI
NYGSEIVHNNKGIISPVLINEKAITGNWNMYKLPFTQQPVVNTGKQKEGKAALYSGTFTV
TKPGDVFLDMHSWGKGIIFVNGHNLGRYWQVGPQQTLYLPGCWLKTGTNNIVVFEQLNVG
IKPEIPTVMKPLLKELKSE

BLAST