GenomeNet

>nmc:NMC0680 type II restriction enzyme NmeDIP; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MSGQKLTAANLVSAIDSLKKNVNYNYVNSSNTHTIQIVHVEKPEGPIKIKRGDTETSISK
QAIWRLADALSTGEPVNVDRVFGASYNFRSALEALLAHTPEIYWCKLQRIQPGLNKSEVV
EGHKHIIWLPDRPHEKGVMKEYETDVVISEIPSNNVVYDALSLPSTHSEIDIDVKRRHVQ
IQIALSAIGFQLGFRTWIARNDQGISYGDKKIADLDGIVQKIESEKLISSFDGAVQAAMN
IDCIWFRNGKLMPAVMEVEHSTGVRSGLARMKQLKDLLPPYANTRWVIVAPDEDRDKVFK
EANVPMFKNLDTQYFPYSAVEELYSLCIRRKLTNKAVNEEFLDCFMEKCVM

BLAST