GenomeNet

>nmc:NMC0680 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) Putative type II restriction enzyme NmeDIP (A)
MSGQKLTAANLVSAIDSLKKNVNYNYVNSSNTHTIQIVHVEKPEGPIKIKRGDTETSISK
QAIWRLADALSTGEPVNVDRVFGASYNFRSALEALLAHTPEIYWCKLQRIQPGLNKSEVV
EGHKHIIWLPDRPHEKGVMKEYETDVVISEIPSNNVVYDALSLPSTHSEIDIDVKRRHVQ
IQIALSAIGFQLGFRTWIARNDQGISYGDKKIADLDGIVQKIESEKLISSFDGAVQAAMN
IDCIWFRNGKLMPAVMEVEHSTGVRSGLARMKQLKDLLPPYANTRWVIVAPDEDRDKVFK
EANVPMFKNLDTQYFPYSAVEELYSLCIRRKLTNKAVNEEFLDCFMEKCVM

BLAST