GenomeNet

>nme:NMB0336 K00208 enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10] | (RefSeq) fabI; enoyl-(acyl carrier protein) reductase (A)
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG

BLAST