GenomeNet

>nme:NMB0726 type II restriction enzyme HgaI (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MTTARWVIDKHLQNFHILCKFAGILKTNSFISVEDKAKLSEKLEKLDLYHRRNTGKSLDA
TTHKIKELSFYMFGYRDVCGQVTQKFLFSPLGNLFLKHLDNNEYIQKIFLTMLWAIPFPH
PYIKTDESIQLYPMRLIFKLLSDERLDCKLFSYEYIYLISFVKSADQNSYEKLVQDILVL
RTCAEVKIKHQLTAENSRSHAYVNAAHEWESYFSKTLTDAGVLQKTDGKIICRLKHGKTE
TYRKVTSSEFSIPKQLQEFVKKLQSAYSFSEMPLNLNDSDRLKIDVIKEIYSFYPKELLE
EIGELKDEAAYELLHLPRLIEQYADNNNGTEAYLFEDVLEMGFNMFYNVEAKKIGGPGNT
DLECLYITQKRKFAVEAKSTKNKLSGINSGRLEDHKNKIKAIYTIVVTPRYVPAVLSDIR
NCPIVIIRANTFAEFLYNCLINRSSIPEIDYRYFDEIIIKNLGKDISSEISNLTMQQFAS
NTTMEAYST

BLAST