GenomeNet

>nme:NMB1703 K09458 3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179] | (RefSeq) fabF-2; 3-oxoacyl-ACP synthase (A)
MLNTRRVAVTGIGGITAFGRDWQSIQAAFKAEKNAVKYMDWHERFPELEAQLGAPIENYA
PPKHWTRKQLRSMGRVSYLCVDAAEQALADAGLLGDESITDGRMGVACGSSSGSTKDIGD
VGELLLTGTSRNFSANTYVRMMPHTTAANIGIFFGLKGRIIPTSSACSSGSQGIGYAYEA
IKYGLTDMMLAGGGEEFFPSEVYVFDSLYAASRRNGEPEKTPRPYDANRDGLVIGEGAGI
FVLEELEHAKRRGAIIYAELVGYGANSDAYHISTPRPDAQGAILAFQTALQHANLAPEDI
GWINLHGTGTHHNDNMESRAVAAVFGNNTPCTSTKPQTGHTLGAADAIEAAFAWGIADRQ
SNPEGKLPPRLWDGQNDPNLPAINLTGSGSRWETEKRITASSSFAFGGSNCVLIIG

BLAST