GenomeNet

>nme:NMB1896 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) dpnC; type II restriction enzyme (A)
MNLFFDTELGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRFANNKPVADLFCPNCH
EQYELKSKNQKTIGNSVPDGAYHTMLERIRSDTNPNFFFLAYKKADYSIRQLVLVPKHFI
TPDMIIPRNKGIKNRPNHIMCSINLAPLPESGKIFLIDNSRIIEPETVLKKWQSNLFLRN
QNAERKGWLLAVMKCIDQLPEEFTLSQMYEFENKLSIQFPQNNHIRDKIRQQLQILRDQN
TIEFIGRGLYKKSINCAQLPRYFDFKS

BLAST