GenomeNet

>nme:NMB1896 dpnC; type II restriction enzyme DpnI (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MNLFFDTELGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRFANNKPVADLFCPNCH
EQYELKSKNQKTIGNSVPDGAYHTMLERIRSDTNPNFFFLAYKKADYSIRQLVLVPKHFI
TPDMIIPRNKGIKNRPNHIMCSINLAPLPESGKIFLIDNSRIIEPETVLKKWQSNLFLRN
QNAERKGWLLAVMKCIDQLPEEFTLSQMYEFENKLSIQFPQNNHIRDKIRQQLQILRDQN
TIEFIGRGLYKKSINCAQLPRYFDFKS

BLAST