GenomeNet

>nme:NMB1921 K00059 3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100] | (RefSeq) fabG; 3-ketoacyl-ACP reductase (A)
MSTQDLNGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGR
VLNSAEPETIESLIADIEKAFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFR
ASKAVLRGMMKQRSGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITV
NCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLH
VNGGMLMP

BLAST