GenomeNet

>nml:Namu_0128 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MAADSATVEVDGHRIALTHLRKVLYPASGTTKSEVIAYFAEVAHAMIPHLADRPVTRKRW
PDGVTTAPFFHKDLPKGTPSWVPRRTIRHSDGPKDYPLVDSPATLAWLGQIAALELHVPQ
WTFGSAAASVAGGDGEITEAVFDAVHPNRLVFDLDPGPGVELVDCAHVARAVRERMGGAA
LVPVTSGSKGIHLYAWLDGSLTSDDASAYAREIAEAIEQDMPDLVVSRMAKSLRRGKVFI
DWSQNNGSKTTIAPYSLRGREHPTVAAPRTWEELADPELRHLEYTEVLELLAAAPDPMQG
LEDGDNDGAETRGGSRRRGRGPDTKLDTYRSMRSADKTPEPVPEPGLLPQGDDDTFVIQE
HHARRLHYDFRLERDGVLVSWAVPKGVPESTGRNHLAVHTEDHPMDYADFAGEIPHGEYG
GGTVSIWDRGTYATEKWREDEVIIVLHGGKARGRYALIRTGGKNWLMHRMKDQSPQPKQY
DDHRPATPTAPVTARPAPARSTRPEPPKDLRPMLATAGSVEDVADERRWRFEGKWDGIRA
IATVGPSGLTLRSRLGNDVTPTYPELAVLAELLDGHSAVLDGEIVALQDGRTSFHEMQKR
MNVQRARDVARVMRDVPVQFWIFDVLNLDGISLLDKRYDDRRRILEALPLTGGVCLVPPQ
LAGPARDALRGSADRQWEGIVAKLGDSTYQPGRRSHSWLKIKNFLDLEVVVVGWSPGTGR
REGTVGALLLAVPDGAGGLRYAGKVGTGFTDAILDQLMQALAPLRADRSAVADTIPRADA
AGAIWVRPELVGEVKYGQWTPERRLRATSWRGLRPDKTVADLIAGSAPPPS

BLAST