GenomeNet

>nml:Namu_0584 DNA polymerase LigD, polymerase domain-containing protein (A)
MARSRDTSEPVELTVGERTVRVTHPERVYFPATGATKLDLVEYYLSVGDGIVNALRERPC
MMHRFPEGLAGDKVHQKRLPRGAPPWVQTVTLFFPRFKRTADELCVTELASVIWAVQMST
VEFHPWNSRRADTEKPDEWRIDLDPMPDCDFARVRRVAHVAHEVLDELGAVGWPKTSGGK
GLHIYVRIPPQWGFADVRRAALAFAREVERRAPQDVTTAWWRKDRDPAMLFVDYNQNARD
HTIASAYSVRGTPRGTVSTPIRWTEIDDVLPDDFTIATVPARYAELGDLHAGIDQAVFPI
DQLLQWADRDERDGRPDPGGADAVDLDAP

BLAST