GenomeNet

>nml:Namu_0821 DNA primase small subunit (A)
MGRSASATVSVGERDVRVSSPDRVVYEATERTPAISKLQVCEYFAAVGEVMLRSIGQRPT
AMERWPSGWREGMRLATGPQDRDADGFYQKRLPKGAPDYIETVTITFPSRRTADELCPTE
PAALVWAAQMGALTFHPWPVRRPDVDHPDELRIDLDPQPGTSFADAKRVAAVARDLLAEL
GLRGYPKTSGNRGVHIYVRIAPRWTFDEVRHAAIGLGRELERRDGGVTTAWWKEERGTRL
FLDYNQNLRDRTIASAWSLRARPGAPVSTPVTWERLAEIDDPREFNLTTIPQYLTDGDPW
ADMDDQAYSLDPLLELWETLPGGELNWPPDYPKQQGEPPRVQPSKKVAEHWDEHGNRIEP

BLAST