GenomeNet

>nml:Namu_0821 DNA primase small subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MGRSASATVSVGERDVRVSSPDRVVYEATERTPAISKLQVCEYFAAVGEVMLRSIGQRPT
AMERWPSGWREGMRLATGPQDRDADGFYQKRLPKGAPDYIETVTITFPSRRTADELCPTE
PAALVWAAQMGALTFHPWPVRRPDVDHPDELRIDLDPQPGTSFADAKRVAAVARDLLAEL
GLRGYPKTSGNRGVHIYVRIAPRWTFDEVRHAAIGLGRELERRDGGVTTAWWKEERGTRL
FLDYNQNLRDRTIASAWSLRARPGAPVSTPVTWERLAEIDDPREFNLTTIPQYLTDGDPW
ADMDDQAYSLDPLLELWETLPGGELNWPPDYPKQQGEPPRVQPSKKVAEHWDEHGNRIEP

BLAST