GenomeNet

>nmm:NMBM01240149_0758 hypothetical protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MNMKTLLALAVSAVCSVGVAQAHEHNTIPKGASIEVKVQQLDPVNGNKDVGTVTITESNY
GLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDD
AHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRM
ACGVIK

BLAST