GenomeNet

>nmn:NMCC_0324 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) drg; type II restriction endonuclease (A)
MPRLALLSAASSLCPDFVNPLKLNLKIQNMNLFFDTELGKQQNKATHKIRVMSEAWLEKN
GYCPCCGSKPMKRFANNKPVADLFCPNCHEQYELKSKNQKTIGNIVPDGAYHTMLERIRS
DTNPNFFFLAYKKADYSIRQLVLVPKHFITPDMIIPRNKGIKNRPHHIMCSINLAPLPES
GKIFLIDDSRIIEPETVLKKWQSNLFLRNQNAERKGWLLAVMKCIDQLPEEFTLSQMYEF
ENKLSIQFPQNNHIKDKIRQQLQILRDQNTIEFIGRGLYKKIDKLRPTSKAV

BLAST