GenomeNet

>npe:Natpe_1010 glycerol-3-phosphate dehydrogenase, anaerobic, C subunit; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MSDAERPTDDSSDEFEPIEVFPEAGETDLRPGADDCYKCSTCDTECPVAEVDDEFPGPKF
QGPEQWRLKRQDDHDIDESVMKCSNCMRCDSACPSDVPLSQMHNTARAEYVEENMSKLSR
EYWRNRMLANYRRLAPLGAMFPRTANFVTGLSATQWLGEKLLGITSERDFPSFATETFRE
WWTARGGAQVENPEKRIAYFHGCYSNYNTPEVAKALVRVYEHFGYEIMVPDQDCSGTPMF
ANGMLEDARRAAETNVRELAAAIDEGADIVASCSSCSMSLRQEYPELFDFEDTEAVAANT
WDAVEYLRVHEDLEAELEGTSVGEEFDDFAYHAPCHARNQGLDGQTVELLAAIDGVEAHD
VGDSCSGISGTYGWKEENYETSMEIGAEMFDHMDEADAEAGLTECPTCSMQMEHGTGYEI
THTLEVLAAALVGDGTGANATGARAE

BLAST