GenomeNet

>npp:PP1Y_Mpl3047 K01040 glutaconate CoA-transferase, subunit B [EC:2.8.3.12] | (GenBank) glutaconate CoA-transferase, subunit B (EC:2.8.3.12) (A)
MTQVTLTELCIFAASEAFRGNGEIVATGVGPVPRLGASLAKLTHSPELMMTDGECYLVEQ
PVPIGPRAYDDRKPAGHLPFSRFFDSAVWTGRRHAMVTPTQIDRFGQINLSYMGGTYQQP
KTQMLGVRGFPGNTIYHPNSFFFPAHSPRVFVPGEVDMISGAGYNPAKRVAGGNYSGVDL
RTIVTNLCVIDFGGKDAEGNRAMRVVSLHPGVTFDEVQEATGFALELAEDVAQTPLPGAE
ALEIIARLDPHGIRASVIKDNPPALRG

BLAST