GenomeNet

>npp:PP1Y_Mpl3047 glutaconate CoA-transferase subunit B (EC:2.8.3.12); K01040 glutaconate CoA-transferase, subunit B [EC:2.8.3.12] (A)
MTQVTLTELCIFAASEAFRGNGEIVATGVGPVPRLGASLAKLTHSPELMMTDGECYLVEQ
PVPIGPRAYDDRKPAGHLPFSRFFDSAVWTGRRHAMVTPTQIDRFGQINLSYMGGTYQQP
KTQMLGVRGFPGNTIYHPNSFFFPAHSPRVFVPGEVDMISGAGYNPAKRVAGGNYSGVDL
RTIVTNLCVIDFGGKDAEGNRAMRVVSLHPGVTFDEVQEATGFALELAEDVAQTPLPGAE
ALEIIARLDPHGIRASVIKDNPPALRG

BLAST