GenomeNet

>npu:Npun_F3884 K02358 elongation factor Tu | (GenBank) protein synthesis factor, GTP-binding (A)
MARAKFERNKPHLNIGTIGHVDHGKTTLTAAITMTLAALGQATAKGYDQIDNAPEEKARG
ITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLAKQVGVPSLVVFLNKEDLMDDPELLELVELELRELLSSYDFPGDDIPIIKGSGLQALE
AMTKNPKTKKGENPWVDKIYELMDAVDSFIPTPERDVDKPFLMAVEDVFTITGRGTVATG
RIERGKVKVGDTVELIGLKDTRTTAVTGIEMFKKSLEEGLAGDNAGVLLRGLKKEDIERG
MVIAKPGSITPHTQFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAYTSDEG
KEVEMVMPGDRIKMTVELINAIAIEQGMRFAIREGGRTIGAGVVSKIIK

BLAST