GenomeNet

>npu:Npun_F6257 Glutathione S-transferase, N-terminal domain protein (EC:2.5.1.18); K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIDLYYWTTPNGHKITIFLEEVGLQYTINPVNIGAGDQFKPEFLKISPNNRIPAIVDHEP
VDGGAPISVFESGAILLYLAEKTGKLIPQDLRQRTQVLEWLFWQMGGLGPMAGQNHHFSA
YAPEKIEYAINRYVNETGRLYGVLNKQLADREFVAGDYSIADIAAYPWIVPYERQSQNLE
DFPHLKRWFETIKARPATIRAYEKAEALKAQPLDPDKSRDLLFNQSAKTIQP

BLAST