GenomeNet

>npu:Npun_F6322 glutathione S-transferase domain-containing protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIVVHHLNNSRSQRVLWLLEELGIDYEIKFYERDQKTMLAPASLREVHPLGKSPVITDAE
NTVAESGAIIEYIVDRYGNGQLIPLSGTPERLRYTYWLHYAEGSAMPPLVMNLLFNRFGT
GDSVNEGFIAPQIKLHFDYIEGELRKSTWFVGEEFTAADIQMSFPLEIVAMEAELISSRP
KIKQFIERIHTRLAYKRALERGGRYDFANSIQ

BLAST