GenomeNet

>npu:Npun_R2498 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, N-terminal domain protein (EC:2.5.1.18) (A)
MVLQEKGIDFDLIEIDLQNKPEGFTKVSPYGKVPALTHDDNRVWESAVINEYLDEVFPNP
PLLPNSSIARAQARIWIDFANTRFVPAFSTLLRSSDPQKQEEAKQELYKHLEFIENEGLA
KLSGEGPYWFGESISLVDFTYFPWFERWAALKQYRGFGIPEEFTRVRQWKHALKERESVK
VIAHSKEFYIERYAKFAAPTLAAV

BLAST