GenomeNet

>npu:Npun_R5910 glutathione S-transferase domain-containing protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTTAPLSWEELETLTDYQIDTVNGLTNAKARLRLFGQPESDVRVTLYRDNHAWCPYCQKV
WLWLEEKQIPYRIEKVTMFCYGEKESWYKRKVPSGMLPAIELDGRIIKESDDILIALEKV
FAPLNQGMEDRMVLPLRQLERLLFRAWCVWLCSRAGSSQQEQRNREQFIEMVARIEEALG
RTPSPYFLDSFGIVDVIFTPYLERMNASLYYYKGYSLREENPRLSAWFAAMESRPTYCGT
QSDFHTHAHDLPPQMGGCWENGETQMLLNKARVDNGPWFGLPDVAYPEPENSRMEALKRT
IEHRINIIRVNPLDDKLFDQALRCALTHMMTGEDYVPPSGADVALRYLRDRINVPRDMSI
YAAKRLRESLEKTAALAGDGQPDPIPTKHRRDQDPSNFVIK

BLAST