GenomeNet

>npu:Npun_R5910 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, C-terminal domain protein (A)
MTTAPLSWEELETLTDYQIDTVNGLTNAKARLRLFGQPESDVRVTLYRDNHAWCPYCQKV
WLWLEEKQIPYRIEKVTMFCYGEKESWYKRKVPSGMLPAIELDGRIIKESDDILIALEKV
FAPLNQGMEDRMVLPLRQLERLLFRAWCVWLCSRAGSSQQEQRNREQFIEMVARIEEALG
RTPSPYFLDSFGIVDVIFTPYLERMNASLYYYKGYSLREENPRLSAWFAAMESRPTYCGT
QSDFHTHAHDLPPQMGGCWENGETQMLLNKARVDNGPWFGLPDVAYPEPENSRMEALKRT
IEHRINIIRVNPLDDKLFDQALRCALTHMMTGEDYVPPSGADVALRYLRDRINVPRDMSI
YAAKRLRESLEKTAALAGDGQPDPIPTKHRRDQDPSNFVIK

BLAST