GenomeNet

>nve:NEMVE_v1g160244 K01359 proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] | (RefSeq) hypothetical protein (A)
MFERVPPCRLLKSPIVFWIVLGVISWQGVSGADLSAEERVYTNGWAIHVNGGIEEAKEVA
KAHGFEKVEPIGTLEGYYHLEHPSHPSRSRRSAEDRTDQLRQHRHVTWVEQQHEKVREKR
GFYHDRMVARGIVPRFKDPLWDAQWYLDDKRKDTDLDIHVIPVWKKGISGKGVVVTILDD
GIEHNHTDLIKNYDPNASWDVNDGDNDPFPRYDPTNENKHGTRCAGEVAAEANNTKCGVG
VAFNARIGGVRMLDGRVTDKVEAESLSLNPQYIDIYSASWGPSDDGATVEGPGTLATAAF
LNGIQKGRGGLGSIFVWASGNGGRHGDSCNCDGYTDSIYTLSISSASDHGESPWYSESCS
STLATTFSSGAHGEKRIVTTDLHNTCTERHTGTSASAPLAAGIFALALEVNPKLTWRDMQ
HIVVHTSNHLPLKHDQDWSKNGIDLMVNRKFGFGLLVAEKIVDMANPATYVTVPEKRFCR
GQINQDAKVFKWDKPLTIQLPATGCSGTGDEIRYLEHVQLMVSLDYVRRGDLVIYLTSPM
GTKSCLLSPRKEDSSNEGFSKWPFMTTHSWGEDPRGTWTLEIKDLGDNKANHGTLREWQL
ILHGTKDKPAHQQK

BLAST