GenomeNet

>nve:NEMVE_v1g160244 hypothetical protein; K01359 proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] (A)
MFERVPPCRLLKSPIVFWIVLGVISWQGVSGADLSAEERVYTNGWAIHVNGGIEEAKEVA
KAHGFEKVEPIGTLEGYYHLEHPSHPSRSRRSAEDRTDQLRQHRHVTWVEQQHEKVREKR
GFYHDRMVARGIVPRFKDPLWDAQWYLDDKRKDTDLDIHVIPVWKKGISGKGVVVTILDD
GIEHNHTDLIKNYDPNASWDVNDGDNDPFPRYDPTNENKHGTRCAGEVAAEANNTKCGVG
VAFNARIGGVRMLDGRVTDKVEAESLSLNPQYIDIYSASWGPSDDGATVEGPGTLATAAF
LNGIQKGRGGLGSIFVWASGNGGRHGDSCNCDGYTDSIYTLSISSASDHGESPWYSESCS
STLATTFSSGAHGEKRIVTTDLHNTCTERHTGTSASAPLAAGIFALALEVNPKLTWRDMQ
HIVVHTSNHLPLKHDQDWSKNGIDLMVNRKFGFGLLVAEKIVDMANPATYVTVPEKRFCR
GQINQDAKVFKWDKPLTIQLPATGCSGTGDEIRYLEHVQLMVSLDYVRRGDLVIYLTSPM
GTKSCLLSPRKEDSSNEGFSKWPFMTTHSWGEDPRGTWTLEIKDLGDNKANHGTLREWQL
ILHGTKDKPAHQQK

BLAST