GenomeNet

>nve:NEMVE_v1g163941 hypothetical protein; K00856 adenosine kinase [EC:2.7.1.20] (A)
MAPEAKKYKLELSEGVLLGMGNPLLDISATVDKDFLDKYGLDENNAILAEDKHKPMYQEM
IDKFNVDYLPGGATQNSIRIAQWLLGKETKATSYMGCIGEDAFGKTLTDIATAAGVHVNY
LINKEIPTGTCAVCITGKHRSLVANLAAANNYTKSHLDQPENWALVVKANFFYIGGFFLT
VSPESIVAVGKYAAETDKLFMMNLSAPFLCQFFKEPMMNAMPYIDILFGNETEALVFAKE
QNFKTEDLKEIILKMSKLTKVNEKRSRTVVITHGKKPTLVAQDGEVREFPIIAIKEEDIV
DTNGAGDAFVGGYLSQLVLGKPVEECVRCGHWCANYIIQQSGVVTKGEPGFE

BLAST