GenomeNet

>nve:NEMVE_v1g170524 hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
MWHEANVRITQGGIHTLMFEGIVGYSYQGDIAIDDVTIKSCATRPPFPTTQAPVASCGVR
PSTRIVGGTAAKQGDWPWQAQLRSTSGFPFCGGSLIHPQWVLTATHCVSSRRPTDLNIRL
GAHNRRANLGMEQDIKVEKIIMHPGYRKPVGLAHDIALIKLLKPANLNRHVNLVCLPDAV
PAPTDGTRCWITGWGRLASGGTAPDILQQASVPVVSRARCEKAYPGKIHDSMLCAGLDQG
GIDTCQGDSGGPMVCESRGRFYIHGATSWGYGCAQPGKFGVYAHVKNLVAWVRSEMARN

BLAST