GenomeNet

>nve:NEMVE_v1g190860 K11406 histone deacetylase 4/5 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MLKHQCSCGDATSHPEHPGRLQSIWARLQETGVVNMCDRVRPRKATLAEILSVHSEQHTM
LFGGSTQCRTKAEDGTITTLKCFSSLPCGGMGVDGDTIWNEVHSANAARMAVGCVVELTQ
KVAAQEIKNGMAIVRPPGHHAEAHQAMGFCYFNNVAIAARLLRLKMSIDRVLIVDWDIHH
GNGTQQMFYDDPHVLYISLHRHDDGTFFPGTGKAEECGAGIGVGYNVNIAWSGGLDPPYG
DAEYLAAFRSVVIPIAKEFQPDIILVSCGFDAAAGHSPQLGGYKVSAPCFAHLTNQLMDL
ADGRVVLALEGGYSLPSLCDAAEACLRALLSDTLPEIPKESLKRAPNPNAIAVLEKTIAI
QSRYWSSVKRSINHISHSVVEAQQREKEEAETVSALASLSMGVVQDSKVADVQMEDDS

BLAST