GenomeNet

>nve:NEMVE_v1g201226 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) hypothetical protein (A)
MDCFAEEGDFMKGQFPESFIWGVATAAHQIEGAWNEDGKGPNIWDAFSHKTGNIHNNENA
DIACDSYHKTDEDIQLLKSLGVSHYRFSISWARILPDGLLDVVNKSGVEYYNRVIDKLLA
VNIQPVATLYHFDLPQALQDKGGWLNSRVIEWFAGYARVCFKLFGDRVRLWLTINEPHEE
ALNGYGYGNFAPGIKRLDTAPYQVVHNMLRAHASAWHIYDEEFRGSQHGKLSIVTNSQFY
EPKSTKPYDVAAADRGLQWYLGWIAHPVVYGDYPEVMKQVVAEKSKKQGIPCRLPSFTAE
EKTYIKGTIDFFALNFYSASLTEHIDIPMNSNENWNYITDQEIKTSRREHWIKGAPDWLY
CTPFGLRKILNWIKGNYNNPEIIITENGFSCDGEEDLSGDAALEDTHRVNYLKGYLNQAL
KSVIKDGVQLTGYFLWSLMDNFEWDDGYKFRFGVHHVDFDDPHKHRTPKKSALVFKEIVA
NKGFI

BLAST