GenomeNet

>nve:NEMVE_v1g210903 hypothetical protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MAGLALPVTKELFYSILIMLSFGPKKCYLQRSEEFGSLNEVVLWKRGDHGVSDYRIPLIT
SLPDGSLIALAEARKHSSSDSGPKFLAMRQSRDQGVTWTNTTFIEDDQEATDGLNLGSIV
VDEITKSVFVMYSFCIHKCKYATTYVIRSDDNGQSWTMPKNISQQLGGLQFAPGPGYGIQ
VECSSPKGYQVEYSSPKCYQVECSSPKGYQVEYSSYKGYQVEYSSPKGYQKALDPWKGRL
IICGHSIGKTEGLYCVASDDHGNSWHRTAELPRTNQFDPNECQMIEQSDGVVLLSARNQQ
HEECRCRMMAKSYDGCETFAHSDIYYDHTLIDPTVAASLLNWKYTVYFSNPASRTLRVNM
TVRVSGDMGETWKGLRPIWQGPSGYSCLSGIPTSQGNDSYIGLAFEKGLISPYESITFVK
LRV

BLAST