GenomeNet

>nve:NEMVE_v1g234345 hypothetical protein; K00933 creatine kinase [EC:2.7.3.2] (A)
MTSVKSAYKQFSADDDFPDLSQHNNYMAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDN
PGHPFIMTVGCVAGDEESYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDPK
YVLSSRVRTGRSIRGFCLPPHCSRAERRSVEKISVDALAKLDGEFKGKYYPLNKMTDEEQ
EQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNENKNFLVWVNEEDHTRVISMEKGG
DMRAVFTRFCNGLNKVESLIKEAGYEFMWNEHLGYVLTCPSNLGTGLRAGVHLKIPLLSQ
DEKRLDAILAKLKLQKRGTGGVDTASVGGVYDISNADRIGFSEVELVQGMVDGVGLLIEM
EKRLEEGKAIDDLIPK

BLAST