GenomeNet

>nve:NEMVE_v1g234345 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) hypothetical protein (A)
MTSVKSAYKQFSADDDFPDLSQHNNYMAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDN
PGHPFIMTVGCVAGDEESYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDPK
YVLSSRVRTGRSIRGFCLPPHCSRAERRSVEKISVDALAKLDGEFKGKYYPLNKMTDEEQ
EQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNENKNFLVWVNEEDHTRVISMEKGG
DMRAVFTRFCNGLNKVESLIKEAGYEFMWNEHLGYVLTCPSNLGTGLRAGVHLKIPLLSQ
DEKRLDAILAKLKLQKRGTGGVDTASVGGVYDISNADRIGFSEVELVQGMVDGVGLLIEM
EKRLEEGKAIDDLIPK

BLAST