GenomeNet

>nve:NEMVE_v1g235255 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MAYKPTQTLRKLAEKSSLDIVSREFADYMDSKDPLRKMRDEFFYPRVKDLPGVDLSLVDG
DQDSIYFCGNSLGLQPRGCRELIDRSLTKWEQMGVLGHTSGWCPWKPIEDILIKPMAEII
GAKDIEVVAMNTLTVNLHMMMVPFYRPTPQRYKILMEGKAFPSDQYAAQSQVHFHGFDPD
KDIIEVFPREGEQSLRTEDILSAIEEHGNSITLVLFSGVQYYTGQFFDMKTITAAAQKKG
CVVGWDLAHAVGNVELHLHDWNVDFACWCTYKYLNSGPGGIAGAFVHEKHAYNFELPKFA
GWWGTDRNSRFQMRKEFEQIPGAHGYQCSNPPVFQCLLLRASLDVFEKTSVKEIRAKGDL
LTAYLELLLLHYFSPSNDITKNGNTPHVSIITPADPKDRGCQLSVKFSVPVDKVFEELCK
RGFVGDIRHPDVMRIAPAPLYNSFADVHRFISMLNAAFKTITPNS

BLAST