GenomeNet

>nve:NEMVE_v1g236165 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MASKKRRTVSNGYRSTGKVLTGGSMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFK
EVVKANIGDAHALGMKPLKFPRQVLALCVNPALLDDPSFPSDAKDRARRILNSTRGFSMG
AYSDSVGLEAIREDVTKYIEERDGHPANIEDIYLTNGASEGIRSILKLLQTHVSEGNERA
GVMIPIPQYPLYSATLLELNSHQINYYLDEANGWSLDIDEMRRAINEARKHCVPRALCVI
NPGNPTGQVLSYENIQQVIRFCKEEKLFIMADEVYQANVYAEDAKFHSFKKVLRDMGPEY
EDMELASFHSTSKGFLGECGFRGGYMEIVGLDPEVKFHLNKMLSAKLCSCITGQAMMDCL
VNPPRPGDESYDEFTKEKEAVLASFKERAQLITKTFNSVEGIQCNESMGAMYSFPGLELP
HKAVVAAKSRGLHPDSFYAMELLEQTGLCVVPGNGFGQKDGTYHFRLTILPPIEKLKPLF
ESFKDFHSKFLAKYKD

BLAST