GenomeNet

>nve:NEMVE_v1g80162 K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
YITECIAGPGACIDIGKPFYPGCCCEECLVEECSCLVKYGSPYHKQDGKTLLTRTQHDGI
SQPIFECNSQCNCDLSCYTKLVQKLIQTRLEVFKSKHKLWGLRTLEHISQGQFICEYAGE
VLSYKEAKKRTIEGKGRPNYIITVKEHISGGKILRTHVDPRIYGNAGRFINHSCDPNLVM
VPVRVDSLIPKLALFASKDIFPNEELSFDYSGGRCGLPSSSCADDPALCLPCYCNSSNCT
GFLPYEASLF

BLAST