GenomeNet

>nve:NEMVE_v1g97278 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) hypothetical protein (A)
EANRKAHNTAFEQEGLIVRRGQEFELTIKFDRNYNADTDQLTLQLVTGERPQQSKGTIVR
IKEHTATTRGSWSMEVTSVKGGSVSVKVMSPATAPIGKYQLYVETEVKGAKDGKKLRFRS
MQAVIIVLFNAWCKDDDVYMGDESHRQEYVMNETGRIWVGSSRNNYGRPWNFGQFEDVVL
ENALYLLDKAELGISARSSPVAISRVISQMANHNDRDGGILYGRWTEKYPKNSTKPWDWV
GSVKILEKFDRRKYTVRYGQCWVFSGLVTTLCRALGIPTRSVTNFKSAHDTDSSMTIDFH
FDEAGEPMDDLDDSVWNFHVWNESFFKRPDLPAGYDGWQVHDATPQETSEGVFRCGPCPV
KAVKNGEVYVPYDTKFVFAEVNGDRVYWDVHSDGEMEVYRIDKQSIGKNISTKAVGSDER
EDITHLYKFPEGDHAEREAVHLAHKYSSRRDEDIYEEKRVNDVTFALDVKDDVIIGSDFD
VVLKMTNTSKEKRTVKIAMTAKSTFYTGRSNYNVTNLKDEVELEANKDETIILAIKQADY
VRPKQKCDEPMNIFVRAHVQQTDQRYASMETATLKKPVLKAMVKILAWSPSGEEFEMKFY
FTNPLPIKLTDISFDMEASRVKPRSLEKTPVGPNEKATVTITFKSSRRGKREITATFSCD
QLGEITESFNVRIK

BLAST