GenomeNet

>nvi:100119074 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) Sdha; succinate dehydrogenase complex, subunit A, flavoprotein (Fp) (A)
MSGLLKLSGLLAKGLPSTTLNKLGLPIISQRALHYTPNSGFAKTSDGISQNYPVVDHTFD
AVVVGAGGAGLRAAYGLVEEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTEGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSFDCNYFIEYFALDLLMEDGECRGVIALCLEDGT
LHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVLT
SKNNQDSVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTISEENKPGEKIGS
LRTNAGEESVANLDKIRNAKGNISTAELRLTMQKTMQTHAAVFRQADTLQEGCKKMSALY
KKLDDLKITDRSLVWNSDLIETLELQNLMVNAMQTIYAAENRKESRGAHAREDFKDRIDE
YDYSKPLEGQQPKPLDQHWRKHTLTHVDINTGDVKIDYRPVIDHTLDDKECKTVPPAIRS
Y

BLAST